Free software downloads



SoftwareNest Address

Related software to Address





Showing : 1 - 10 from 21

Handy Address Book 5.4 screenshot
Handy Address Book
Full Featured Address Book with Web Publishing and Phone Dialing
Date Added:08 Mar 2012

Tags: address book softwareaddress bookaddressphonesoftwarephone bookvCard

Average Rating:


User Rating:
Total downloads
231
Last week
1

ReminderCube
Desktop calendar with many functions.Events,tasks,GMail checker,notes,feed RSS
Date Added:21 Mar 2012

Tags: calendarreminderrssnoteslauncherGMail checkerimage viewer

Average Rating:


User Rating:
Total downloads
324
Last week
1

Mobile Master 7.9.15 screenshot
Mobile Master
The mobile phone and sync tool for your mobile/cell phone, handset
Date Added:14 Mar 2012

Tags: mobilecell phonesynccontactsaddressessmartphoneiPhone

Average Rating:


User Rating:
Total downloads
334
Last week
4

eMail Verifier
E-mail checking tool to verify your customers e-mail addresses
Date Added:14 Mar 2012

Tags: verifiercheckermailemaile-mailvalidvalidity

Average Rating:


User Rating:
Total downloads
354
Last week
2

IP Shifter
Help you to change your TCP/IP related settings easily and quickly
Date Added:23 Mar 2012

Tags: Network profileIP changemodify ipswitch ipip switcherTCP/IP settingsIP address

Average Rating:


User Rating:
Total downloads
296
Last week
5

SI Ping 1.0 screenshot
SI Ping
Ping remote Internet hosts with free visual Ping for Windows
Date Added:23 Mar 2012

Tags: pingvisual pinglookuptracerouteping remote computerping ip addresscheck online

Average Rating:


User Rating:
Total downloads
392
Last week
5

Boxxer Rebrandable Email Extractor Free 2.3 screenshot
Boxxer Rebrandable Email Extractor Free
Free Email Extractor to Extract Email id's from internet based on a keyword.(eg: Hotels in California) and other website URLs.Also Extracts Unli
Date Added:16 Aug 2012

Tags: Email ExtractorEmail SpiderEmail HarvesterEmail SearchEmail SearcherEmail addressEmail id's

Average Rating:


User Rating:
Total downloads
214
Last week
1

Forum Proxy Leecher
Get thousands of proxies in seconds by Forum Proxy Leecher.
Date Added:23 Mar 2012

Tags: Forum Proxy Leecherbuy proxybuy proxy listbuy proxiesfind proxyget around proxyget proxy

Average Rating:


User Rating:
Total downloads
340
Last week
4

Active Whois Browser 3.3 screenshot
Active Whois Browser
Browse all information for an IP address or domain name with a single click!
Date Added:23 Mar 2012

Tags: activewhoisactivewhoisdomainsearchfindIP

Average Rating:


User Rating:
Total downloads
222
Last week
3

Utility Ping 2.1.2 screenshot
Utility Ping
Utility Ping -professional ping utility to check network connection
Date Added:23 Mar 2012

Tags: Utility PingPing utilitycheck network connectionpingping IPping IP addressping network

Average Rating:


User Rating:
Total downloads
302
Last week
3


 1  2  3   Next » 



Copyright (c) 2012 SoftwareNest. All rights reserved. All Copyrights & Trademarks are property of their respective owners.